PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619815.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 318aa    MW: 35648.9 Da    PI: 6.893
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619815.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.55.6e-071158247
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     ++W+ ++d  + +a   +  +   +W++Ia  ++  +tl q+++++ ++
   XP_013619815.1 11 LSWSRDDDIAFERALVVYTDEtdnRWEKIADSVP-EKTLAQVIEHYESL 58
                     58*****************99*************.9**********876 PP

2Myb_DNA-binding445.3e-14115159347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E+ +++ + +++G+g+W++I+r++ ++Rt+ q+ s+ qky
   XP_013619815.1 115 PWTPLEHSQFLLGLNKYGKGDWRSISRHVVLTRTPTQVASHAQKY 159
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007176.0E-8961IPR001005SANT/Myb domain
CDDcd001675.77E-71259No hitNo description
SuperFamilySSF466894.95E-101267IPR009057Homeodomain-like
PROSITE profilePS500906.331259IPR017877Myb-like domain
PROSITE profilePS5129416.609107164IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-9108160IPR009057Homeodomain-like
SuperFamilySSF466893.16E-15109164IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-13112162IPR006447Myb domain, plants
SMARTSM007174.3E-10112162IPR001005SANT/Myb domain
CDDcd001671.46E-9115160No hitNo description
PfamPF002492.1E-11115159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MIISEKTGGG LSWSRDDDIA FERALVVYTD ETDNRWEKIA DSVPEKTLAQ VIEHYESLLH  60
DVMMIESGIV PLPDYNDVPI ETNVRERSIG ERSINRKCEY KQEDEPKPKR RKAIPWTPLE  120
HSQFLLGLNK YGKGDWRSIS RHVVLTRTPT QVASHAQKYF ARLSATNRSR QRHSIHDVNV  180
SESSNISAMK APITCQDAQA TSQPSVDHHA YETPAIWNTQ ATSPTSLDHH VFGTPTIWNM  240
QAASQPSANV PLYGTPTTGQ SMVGPYVLPY GTHDMNLFAP PYMAYRAQHH STPYSPVPSA  300
SLNTGIVPDN MTNIPTSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-13375173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619815.10.0PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A0D3AXZ80.0A0A0D3AXZ8_BRAOL; Uncharacterized protein
STRINGBra029380.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133911628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23650.11e-107Homeodomain-like transcriptional regulator